PE Rabbit anti-Human CD32 monoclonal antibody
Product Sizes
10 tests
£ POA
A28015-10TESTS
100 tests
£247.00
A28015-100TESTS
200 tests
£402.00
A28015-200TESTS
500 tests
£818.00
A28015-500TESTS
About this Product
- SKU:
- A28015
- Additional Names:
- CD32|CD32A|CDw32|FCG2|FcgammaRIIa|FcGR|FCGR2|FCGR2A1|IGFR2
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28015
