Chemerin Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28009-20UL
100 ul
£336.00
A28009-100UL
500 ul
£1258.00
A28009-500UL
1000 ul
£2228.00
A28009-1000UL
About this Product
- SKU:
- A28009
- Additional Names:
- 0610007L05Rik
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable signaling receptor binding activity. Involved in several processes, including positive regulation of fat cell differentiation; regulation of insulin receptor signaling pathway; and regulation of primary metabolic process. Acts upstream of or within brown fat cell differentiation. Located in extracellular region. Is expressed in genitourinary system; jaw; and retina. Orthologous to human RARRES2 (retinoic acid receptor responder 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 18kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28009
