LRG1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28008-20UL
100 ul
£336.00
A28008-100UL
500 ul
£1258.00
A28008-500UL
1000 ul
£2228.00
A28008-1000UL
About this Product
- SKU:
- A28008
- Additional Names:
- 1300008B03Rik|2310031E04Rik|A2GL|Lrg|lrhg
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables transforming growth factor beta receptor binding activity. Acts upstream of or within several processes, including brown fat cell differentiation; positive regulation of endothelial cell proliferation; and positive regulation of transforming growth factor beta receptor signaling pathway. Located in extracellular space. Is expressed in pancreas mesenchyme. Orthologous to human LRG1 (leucine rich alpha-2-glycoprotein 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SLKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28008
