RNASE2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A28007-20UL
100 ul
£336.00
A28007-100UL
500 ul
£1258.00
A28007-500UL
1000 ul
£2228.00
A28007-1000UL
About this Product
- SKU:
- A28007
- Additional Names:
- mR4|Rnase2|RNS2
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable RNA nuclease activity and lipopolysaccharide binding activity. Predicted to be involved in chemotaxis; defense response to Gram-positive bacterium; and innate immune response in mucosa. Predicted to be located in lysosome. Predicted to be active in extracellular space. Orthologous to human RNASE2 (ribonuclease A family member 2) and RNASE3 (ribonuclease A family member 3).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 18kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- QAQILSQKFYTQHIYNSTYPRCDAVMRVVNRYRPRCKDINTFLHTSFADVVAVCGHPNITCNNLTRKNCHASSFQVFITFCNLTMPTRICTQCRYQTTGSVKYYRVACENRTPQDTPMYPVVPVHLDGTF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A28007
