CD133 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A28001-5UL
20 ul
£164.00
A28001-20UL
100 ul
£342.00
A28001-100UL
500 ul
£1455.00
A28001-500UL
1000 ul
£2704.00
A28001-1000UL
About this Product
- SKU:
- A28001
- Additional Names:
- 4932416E19Rik|AC133|CD133|Prom|Prom-1|Proml1
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable actinin binding activity; cadherin binding activity; and cholesterol binding activity. Involved in camera-type eye photoreceptor cell differentiation and retina layer formation. Located in several cellular components, including brush border; photoreceptor outer segment; and prominosome. Is expressed in several structures, including brain; eye; genitourinary system; intestine; and neural ectoderm. Used to study retinitis pigmentosa 41. Human ortholog(s) of this gene implicated in cone-rod dystrophy 12; retinal macular dystrophy 2; and retinitis pigmentosa 41. Orthologous to human PROM1 (prominin 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 120 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- EGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEPEIIVLALKIALYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A28001
