ABflo[R] 488 Rabbit anti-Cat CD8a monoclonal antibody
Product Sizes
100 ug
£277.00
A27984-100UG
200 ug
£419.00
A27984-200UG
500 ug
£866.00
A27984-500UG
About this Product
- SKU:
- A27984
- Additional Names:
- CD8A
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 32- 34kDa
- Purification:
- Affinity Purified
- Reactivities:
- Feline
- Sequence:
- SPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWLFQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCSVVSNSVLYFSAFVPVFLPVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27984
