APC/Cyanine7 Rabbit anti-Human CD71 monoclonal antibody
Product Sizes
10 tests
£ POA
A27968-10TESTS
100 tests
£229.00
A27968-100TESTS
200 tests
£360.00
A27968-200TESTS
500 tests
£741.00
A27968-500TESTS
About this Product
- SKU:
- A27968
- Additional Names:
- CD71|IMD46|p90|T9|TFR|TFR1|TR|TRFR
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC-Cyanine 7
- Extra Details:
- This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27968
