PE Rabbit anti-Human CD205/DEC-205 monoclonal antibody
Product Sizes
10 tests
£ POA
A27942-10TESTS
100 tests
£324.00
A27942-100TESTS
200 tests
£532.00
A27942-200TESTS
500 tests
£1133.00
A27942-500TESTS
About this Product
- SKU:
- A27942
- Additional Names:
- CD205|CLEC13B|DEC-205|GP200-MR6|LY-75
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- CD205 is a 210-kDa type C lectin transmembrane protein, also known as DEC-205. It belongs to the macrophage mannose receptor family and is highly expressed in dendritic cells and thymic epithelial cells. Unlike murine CD205, human CD205 is also expressed at low levels on T cells, B cells, NK cells, and monocytes. CD205 functions as an endocytic receptor involved in antigen uptake/processing and the clearance of apoptotic cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 198kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- CEDNWEKNEQFGSCYQFNTQTALSWKEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEEVWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKGEKLNDASSDKMC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27942
