PE/Cyanine5 Rabbit anti-Mouse CD5 monoclonal antibody
Product Sizes
2.5 ug
£ POA
A27926-2.5UG
50 ug
£217.00
A27926-50UG
100 ug
£312.00
A27926-100UG
200 ug
£515.00
A27926-200UG
500 ug
£1098.00
A27926-500UG
About this Product
- SKU:
- A27926
- Additional Names:
- Ly-1|Ly-12|Ly-A|Lyt-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE-Cyanine 5
- Extra Details:
- CD5 is a type I transmembrane protein belonging to the scavenger receptor cysteine-enriched (SRCR) family, characterized by the presence of at least one SRCR domain containing 90-110 amino acids. CD5 is expressed in all mature T cells, B-1A subsets of mature B cells, and certain leukemia B cells. It is elevated in regulatory T and B cells (Tregs/Bregs). CD5 expression was also elevated in incompetent T and B cells. Elevated levels of CD5 have also been found in many autoimmune diseases. CD5 binds to T cell receptors (TCR) and negatively regulates T cell activation and differentiation. The expression of CD5 in tumor-infiltrating T lymphocytes was negatively correlated with their antitumor activity. Recently, it has been reported that CD5 binds directly to IL6 and mediates downstream signal transduction. CD5+ B cells promote tumor growth in animal models. Agents targeting CD5 are being actively explored as therapeutic interventions for cancer and other conditions.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 54kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27926
