ABflo[R] 647 Rabbit anti-Mouse CD352/SLAMF6 monoclonal antibody
Product Sizes
5 ug
£ POA
A27923-5UG
50 ug
£229.00
A27923-50UG
100 ug
£336.00
A27923-100UG
200 ug
£532.00
A27923-200UG
500 ug
£1145.00
A27923-500UG
About this Product
- SKU:
- A27923
- Additional Names:
- KAL1|KAL1b|Ly108|NTB-A|NTBA|SF2000
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- SLAMF6 (CD352/NTB-A) is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family of immunoregulatory receptors. Like other members of the SLAM receptor family, SLAMF6 possesses an extracellular region containing immunoglobulin (Ig)-like domains and an intracellular domain harboring conserved tyrosine-based signaling motifs. Upon phosphorylation, these motifs recruit the SAP (SLAM-associated protein) and EAT-2 adaptor signaling molecules. SLAMF6 is expressed on the surface of multiple immune cell lineages, including B cells, T cells, and natural killer (NK) cells. Its activation is triggered by homophilic interactions mediated through its extracellular domain. Functional studies demonstrate that SLAMF6 engagement in T cells promotes cellular activation and cytokine production. Similarly, ligand-induced homotypic binding of SLAMF6 in NK cells initiates signaling cascades that enhance proliferation, cytotoxic activity, and cytokine secretion.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 39kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27923
