ABflo[R] 450 Rabbit anti-Human CD303/BDCA-2 monoclonal antibody
Product Sizes
10 tests
£ POA
A27911-10TESTS
100 tests
£354.00
A27911-100TESTS
200 tests
£574.00
A27911-200TESTS
500 tests
£1229.00
A27911-500TESTS
About this Product
- SKU:
- A27911
- Additional Names:
- BDCA-2|BDCA2|CD303|CLECSF11|CLECSF7|DLEC|HECL|PRO34150
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 450
- Extra Details:
- This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 21kDa/25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27911
