HDAC6 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A27908-20UL
100 ul
£336.00
A27908-100UL
500 ul
£1258.00
A27908-500UL
1000 ul
£2228.00
A27908-1000UL
About this Product
- SKU:
- A27908
- Additional Names:
- Hd6|Hdac5|mHDA2|Sfc6
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables several functions, including cytoskeletal protein binding activity; protein lysine deacetylase activity; and ubiquitin binding activity. Involved in several processes, including positive regulation of type 2 mitophagy; protein destabilization; and tubulin deacetylation. Acts upstream of or within several processes, including aggresome assembly; neuron projection morphogenesis; and protein modification process. Located in several cellular components, including dendrite; microtubule cytoskeleton; and perikaryon. Part of cytoplasmic ubiquitin ligase complex. Is expressed in several structures, including central nervous system; early embryo; gut gland; lung; and metanephros. Human ortholog(s) of this gene implicated in chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia and polycystic liver disease 1. Orthologous to human HDAC6 (histone deacetylase 6).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A27908
