FOXO3A Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A27907-20UL
100 ul
£336.00
A27907-100UL
500 ul
£1258.00
A27907-500UL
1000 ul
£2228.00
A27907-1000UL
About this Product
- SKU:
- A27907
- Additional Names:
- 1110048B16Rik|2010203A17Rik|Fkhr2|FKHRL1|Foxo3a
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables DNA binding activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and mitochondrial transcription factor activity. Involved in several processes, including mitochondrial transcription; positive regulation of muscle atrophy; and positive regulation of pri-miRNA transcription by RNA polymerase II. Acts upstream of or within several processes, including extrinsic apoptotic signaling pathway in absence of ligand; female gonad development; and neuronal stem cell population maintenance. Located in cytosol; mitochondrial outer membrane; and nucleus. Part of protein-containing complex. Colocalizes with mitochondrial matrix. Is expressed in several structures, including alimentary system; brain; early embryo; genitourinary system; and hemolymphoid system. Used to study dermoid cyst of ovary. Orthologous to human FOXO3 (forkhead box O3).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 82-97kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A27907
