PE/Cyanine7 Rabbit anti-Mouse CD62L/L-Selectin monoclonal antibody
Product Sizes
10 tests
£ POA
A27889-10TESTS
100 tests
£122.00
A27889-100TESTS
200 tests
£169.00
A27889-200TESTS
500 tests
£312.00
A27889-500TESTS
About this Product
- SKU:
- A27889
- Additional Names:
- CD62L|L-selectin|LAM-1|LECAM-1|LECAM1|Lnhr|Ly-22|Ly-m22|Lyam-1|Lyam1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE-Cyanine 7
- Extra Details:
- Enables cell adhesion molecule binding activity. Acts upstream of or within response to ATP. Located in external side of plasma membrane. Is expressed in brain; brainstem; submandibular gland epithelium; and testis. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in Crohn's disease; IgA glomerulonephritis; and ulcerative colitis. Orthologous to human SELL (selectin L).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27889
