Heme Oxygenase 1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A27713-5UL
20 ul
£164.00
A27713-20UL
100 ul
£342.00
A27713-100UL
500 ul
£1455.00
A27713-500UL
1000 ul
£2704.00
A27713-1000UL
About this Product
- SKU:
- A27713
- Additional Names:
- D8Wsu38e|Hemox|Hmox|HO-1|HO1|Hsp32
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable several functions, including heme binding activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; and protein homodimerization activity. Acts upstream of or within several processes, including cellular response to cadmium ion; cellular response to cisplatin; and regulation of macroautophagy. Located in nucleus. Is active in cytosol. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; respiratory system; and sensory organ. Used to study hemochromatosis and malaria. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and sickle cell anemia. Orthologous to human HMOX1 (heme oxygenase 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28 kDa/33 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27713
