Synaptophysin Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A27659-5UL
20 ul
£164.00
A27659-20UL
100 ul
£342.00
A27659-100UL
500 ul
£1532.00
A27659-500UL
1000 ul
£2704.00
A27659-1000UL
About this Product
- SKU:
- A27659
- Additional Names:
- MRX96|SYN|SYP
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for the identification of neuroendocrine cells and neoplasms. Synaptic proteins including synaptophysin are reduced in brain tissue from patients with Alzheimer's disease.(PMID: 3010302; 21658579)
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- KETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27659
