PE/Cyanine7 Rabbit anti-Mouse CD95/FAS monoclonal antibody
Product Sizes
2.5 ug
£ POA
A27649-2.5UG
50 ug
£211.00
A27649-50UG
100 ug
£306.00
A27649-100UG
About this Product
- SKU:
- A27649
- Additional Names:
- APO1|APT1|CD95|lpr|TNFR6|Tnfrsf6
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE-Cyanine 7
- Extra Details:
- CD95, also known as Fas, is a approximately 45 kD type I transmembrane protein in the TNFR superfamily (TNFRSF6). CD95 was expressed in thymus, spleen, liver, heart, lung, ovary and other organs. CD95 binds ligand (FasL) to form a death-inducing signaling complex (DISC) in cells to induce apoptosis. Cd95-induced apoptosis plays an important role in development and in maintaining peripheral tolerance of the immune system.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 37KDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27649
