APC/Cyanine7 Rabbit anti-Mouse CD69 monoclonal antibody
Product Sizes
2.5 ug
£ POA
A27639-2.5UG
25 ug
£116.00
A27639-25UG
100 ug
£241.00
A27639-100UG
About this Product
- SKU:
- A27639
- Additional Names:
- 5830438K24Rik|AIM|VEA
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC-Cyanine 7
- Extra Details:
- Predicted to enable calcium ion binding activity and identical protein binding activity. Located in external side of plasma membrane. Orthologous to human CD69 (CD69 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27639
