ABflo[R] 647 Rabbit anti-Pig CD138/Syndecan-1 monoclonal antibody
Product Sizes
100 tests
£556.00
A27636-100TESTS
200 tests
£883.00
A27636-200TESTS
500 tests
£1389.00
A27636-500TESTS
About this Product
- SKU:
- A27636
- Additional Names:
- SDC1,syndecan-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 23-250 of pig CD138 (NP_001230119.1).
- Isotype:
- IgG
- Molecular Weight:
- 32kDa
- Purification:
- Affinity Purified
- Reactivities:
- Porcine
- Sequence:
- ETVATNVPPEDQDGSGDDSDNFSGSGAGALPDVTLSQQTPSTWKDTGLLTTMPTAPEPTSPDTVATSTSVLPAGERPGRGRAVLLDLDPGLTAQEKEATHSPSETTQHPTTHRASTAGATTAQVPATSHPHRDVPPDHPETSAPAGHGQLDPHTPGVGDGGPATTEKAAEGEASTQLPVGEGSGEPDFTFDVSGENTAGDALDPDQRNEPPVDQGTTGASQSLLDRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27636
