PE Rabbit anti-Human CD353/SLAMF8 monoclonal antibody
Product Sizes
10 tests
£ POA
A27549-10TESTS
100 tests
£556.00
A27549-100TESTS
200 tests
£883.00
A27549-200TESTS
500 tests
£1389.00
A27549-500TESTS
About this Product
- SKU:
- A27549
- Additional Names:
- BLAME|CD353|SBBI42
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment. The gene is found in a region of chromosome 1 containing many CD2 genes.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 32kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27549
