Biotin Rabbit anti-Human CD34 monoclonal antibody
Product Sizes
10 tests
£ POA
A27536-10TESTS
100 tests
£211.00
A27536-100TESTS
200 tests
£312.00
A27536-200TESTS
500 tests
£532.00
A27536-500TESTS
About this Product
- SKU:
- A27536
- Additional Names:
- CD34|CD34 molecule|GIG3
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- Biotin
- Extra Details:
- The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kDa/41kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27536
