PE/Cyanine7 Rabbit anti-Human/Monkey IFN-gamma monoclonal antibody
Product Sizes
10 tests
£ POA
A27517-10TESTS
100 tests
£294.00
A27517-100TESTS
200 tests
£467.00
A27517-200TESTS
500 tests
£830.00
A27517-500TESTS
About this Product
- SKU:
- A27517
- Additional Names:
- IFG|IFI|IMD69
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE-Cyanine 7
- Extra Details:
- This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27517
