PE Rabbit anti-Mouse CD83 monoclonal antibody
Product Sizes
10 tests
£ POA
A27505-10TESTS
100 tests
£152.00
A27505-100TESTS
200 tests
£217.00
A27505-200TESTS
500 tests
£360.00
A27505-500TESTS
About this Product
- SKU:
- A27505
- Additional Names:
- mCD83
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Acts upstream of or within positive regulation of CD4-positive, alpha-beta T cell differentiation; regulation of cytokine production; and response to organic cyclic compound. Located in external side of plasma membrane. Is expressed in alimentary system; genitourinary system; hemolymphoid system gland; and nervous system. Orthologous to human CD83 (CD83 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 21KDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27505
