Alpha-synuclein Truncation 1-119 monoclonal antibody [MJFF-C-24D2]
Product Sizes
5 ul
£ POA
A27453-5UL
20 ul
£175.00
A27453-20UL
100 ul
£360.00
A27453-100UL
500 ul
£1461.00
A27453-500UL
1000 ul
£2573.00
A27453-1000UL
About this Product
- SKU:
- A27453
- Additional Names:
- NACP|PARK1|PARK4|PD1
- Application:
- Dot Blot, ELISA, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- Target background: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Alpha-synuclein is a neuronal protein that plays many roles in synaptic activity such as membrane trafficking of synaptic vesicles and neurotransmitter release. Multiplications in SNCA have been implicated in genetic forms of Parkinson disease and pathological post-translational modifications of alpha-synuclein are a hallmark of Parkinson's disease. These modifications include phosphorylation, nitration, acetylation, truncation, and aggregation. C-terminal truncations of alpha-synuclein lead to increased aggregation. Evidence for the 1-119 truncation in brains of patients with Parkinson's disease, Lewy Body Dementia (LBD), Multiple Systems Atrophy (MSA), and Alzheimer's disease.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27453
