Biotin Rabbit anti-Mouse NK1.1/CD161c monoclonal antibody
Product Sizes
200 tests
£86.00
A27412-200TESTS
500 tests
£116.00
A27412-500TESTS
About this Product
- SKU:
- A27412
- Additional Names:
- CD161|Klrb1b|ly-55c|Ly-59|Ly55c|Ly59|Nk-1|Nk-1.2|NK-RP1|Nk1|NK1.1|Nk1.2|NKR-P1.9|NKRP1|NKRP140|Nkrp1b|Nkrp1c
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- Biotin
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27412
