PE Rabbit anti-Human CD196/CCR6 monoclonal antibody
Product Sizes
10 tests
£ POA
A27384-10TESTS
100 tests
£306.00
A27384-100TESTS
200 tests
£485.00
A27384-200TESTS
500 tests
£860.00
A27384-500TESTS
About this Product
- SKU:
- A27384
- Additional Names:
- BN-1|C-C CKR-6|CC-CKR-6|CCR-6|CD196|CKR-L3|CKRL3|CMKBR6|DCR2|DRY6|GPR29|GPRCY4|STRL22
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha). This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27384
