Biotin Rabbit anti-Mouse CD8a monoclonal antibody
Product Sizes
10 tests
£ POA
A27373-10TESTS
100 tests
£74.00
A27373-100TESTS
200 tests
£98.00
A27373-200TESTS
500 tests
£122.00
A27373-500TESTS
About this Product
- SKU:
- A27373
- Additional Names:
- Ly-2|Ly-35|Ly-B|Lyt-2
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- Biotin
- Extra Details:
- Enables identical protein binding activity. Acts upstream of or within several processes, including cytotoxic T cell differentiation; defense response to virus; and positive regulation of calcium-mediated signaling. Located in external side of plasma membrane. Is expressed in several structures, including endocrine gland; exocrine gland; genitourinary system; gut; and hemolymphoid system gland. Orthologous to human CD8A (CD8a molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 27kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27373
