PE/Cyanine7 Rabbit anti-Mouse/Rat CD27 monoclonal antibody
Product Sizes
25 ug
£146.00
A27357-25UG
100 ug
£265.00
A27357-100UG
About this Product
- SKU:
- A27357
- Additional Names:
- S152|Tnfrsf7|Tp55
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE-Cyanine 7
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27357
