PE Rabbit anti-Mouse IL-22 monoclonal antibody
Product Sizes
10 tests
£ POA
A27209-10TESTS
100 tests
£193.00
A27209-100TESTS
200 tests
£288.00
A27209-200TESTS
500 tests
£497.00
A27209-500TESTS
About this Product
- SKU:
- A27209
- Additional Names:
- If2b1|IL-22|IL-22a|Iltif|ILTIFa
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables cytokine activity. Involved in negative regulation of inflammatory response. Acts upstream of or within positive regulation of transcription by RNA polymerase II; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Is active in extracellular space. Is expressed in ileum; retina; and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27209
