ABflo[R] 647 Rabbit anti-Mouse I-A monoclonal antibody
Product Sizes
10 tests
£ POA
A27183-10TESTS
100 tests
£503.00
A27183-100TESTS
200 tests
£824.00
A27183-200TESTS
500 tests
£1478.00
A27183-500TESTS
About this Product
- SKU:
- A27183
- Additional Names:
- H-2I|I-Ad, -Ed|I-Eb and I-Ek MHC class II alloantigens|Ia Ag|MHC II
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SERHFVFQFKGECYFTNGTQRIRSVDRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLEQTRAELDTVCRHNYEGVETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLISNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27183
