PE Rabbit anti-Mouse I-A monoclonal antibody
Product Sizes
100 tests
£503.00
A27181-100TESTS
200 tests
£824.00
A27181-200TESTS
500 tests
£1478.00
A27181-500TESTS
About this Product
- SKU:
- A27181
- Additional Names:
- H-2I|I-Ad, -Ed|I-Eb and I-Ek MHC class II alloantigens|Ia Ag|MHC II
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SERHFVFQFKGECYFTNGTQRIRSVDRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLEQTRAELDTVCRHNYEGVETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLISNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQSE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27181
