ABflo[R] 594 Rabbit anti-Mouse CD265/RANK monoclonal antibody
Product Sizes
10 tests
£ POA
A27180-10TESTS
100 tests
£277.00
A27180-100TESTS
200 tests
£437.00
A27180-200TESTS
500 tests
£764.00
A27180-500TESTS
About this Product
- SKU:
- A27180
- Additional Names:
- Ly109|mRANK|ODFR|OFE|Rank|TRANCE-R
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including circadian temperature homeostasis; positive regulation of fever generation by positive regulation of prostaglandin secretion; and tumor necrosis factor-mediated signaling pathway. Acts upstream of or within several processes, including hematopoietic or lymphoid organ development; mammary gland alveolus development; and positive regulation of bone resorption. Located in cell surface. Is expressed in bladder and lymphatic system. Human ortholog(s) of this gene implicated in Paget's disease of bone; autosomal recessive osteopetrosis 7; bone development disease; familial expansile osteolysis; and osteoporosis. Orthologous to human TNFRSF11A (TNF receptor superfamily member 11a).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 67kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27180
