PE Rabbit anti-Mouse CD103 monoclonal antibody
Product Sizes
10 tests
£ POA
A27132-10TESTS
100 tests
£104.00
A27132-100TESTS
200 tests
£146.00
A27132-200TESTS
500 tests
£229.00
A27132-500TESTS
About this Product
- SKU:
- A27132
- Additional Names:
- A530055J10|alpha-E1|alpha-M290|aM290|CD103
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable metal ion binding activity. Predicted to act upstream of or within cell adhesion and integrin-mediated signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; genitourinary system; lymph node; nasal septum; and nucleus pulposus. Orthologous to human ITGAE (integrin subunit alpha E).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 129kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- EDGTEIAIVLDGSGSIEPSDFQKAKNFISTMMRNFYEKCFECNFALVQYGAVIQTEFDLQESRDINASLAKVQSIVQVKEVTKTASAMQHVLDNIFIPSRGSRKKALKVMVVLTDGDIFGDPLNLTTVINSPKMQGVVRFAIGVGDAFKNNNTYRELKLIASDPKEAHTFKVTNYSALDGLLSKLQQHIVHMEGT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A27132
