APC/Cyanine7 Rabbit anti-Human/Monkey CD8a monoclonal antibody
Product Sizes
100 tests
£265.00
A26941-100TESTS
200 tests
£419.00
A26941-200TESTS
500 tests
£735.00
A26941-500TESTS
About this Product
- SKU:
- A26941
- Additional Names:
- CD8|CD8alpha|Leu2|p32
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC-Cyanine 7
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 21kDa/25kDa/30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26941
