ABflo[R] 647 Rabbit anti-Mouse S100A9 monoclonal antibody
Product Sizes
10 tests
£ POA
A26916-10TESTS
100 tests
£556.00
A26916-100TESTS
200 tests
£883.00
A26916-200TESTS
500 tests
£1389.00
A26916-500TESTS
About this Product
- SKU:
- A26916
- Additional Names:
- 60B8Ag|BEE22|Cagb|GAGB|L1Ag|MRP14|p14
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Involved in peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; and regulation of translation. Acts upstream of or within several processes, including actin cytoskeleton reorganization; astrocyte development; and regulation of integrin biosynthetic process. Predicted to be located in cell junction; cytosol; and nucleoplasm. Predicted to be active in cytoplasm; extracellular space; and nucleus. Is expressed in several structures, including jaw; liver; otic capsule; skeleton; and spleen red pulp. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A9 (S100 calcium binding protein A9).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 13kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26916
