CDKN2A/p19ARF Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A26879-20UL
100 ug
£342.00
A26879-100UG
About this Product
- SKU:
- A26879
- Additional Names:
- Arf|ARF-INK4a|CDKN2A/p19ARF|INK4a-ARF|Ink4a/Arf|MTS1|p16|p16(INK4a)|p16INK4a|p19<ARF>|p19ARF|Pctr1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19KDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26879
