PE Rabbit anti-Mouse CD200/OX-2 monoclonal antibody
Product Sizes
10 tests
£ POA
A26859-10TESTS
100 tests
£229.00
A26859-100TESTS
200 tests
£354.00
A26859-200TESTS
500 tests
£598.00
A26859-500TESTS
About this Product
- SKU:
- A26859
- Additional Names:
- Mox2|OX2
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable protein binding activity involved in heterotypic cell-cell adhesion. Involved in negative regulation of cell population proliferation; negative regulation of macrophage activation; and negative regulation of neuroinflammatory response. Located in cell surface. Is expressed in several structures, including anterior naris; aorta; bone; nervous system; and retina. Used to study autoimmune disease. Orthologous to human CD200 (CD200 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 31kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26859
