CCL25 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A2685-5UL
20 ul
£152.00
A2685-20UL
100 ul
£336.00
A2685-100UL
500 ul
£1258.00
A2685-500UL
1000 ul
£2228.00
A2685-1000UL
About this Product
- SKU:
- A2685
- Additional Names:
- CCL25|Ck beta-15|Ckb15|SCYA25|TECK|TECKvar
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20KDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2685
