ABflo[R] 647 Rabbit anti-Human IgA1 monoclonal antibody
Product Sizes
10 tests
£ POA
A26804-10TESTS
100 tests
£324.00
A26804-100TESTS
200 tests
£509.00
A26804-200TESTS
500 tests
£782.00
A26804-500TESTS
About this Product
- SKU:
- A26804
- Additional Names:
- IgA1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. In normal adult serum, the approximate percentage composition of IgA with respect to is subclasses is IgA1:90% and IgA2:10%. In secretory IgA, the subclass proportions may approach 50:50. The clinical significance of the subclasses has yet to be determined.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kDa/42KDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Secondary Antibodies
- Manufacturer's Data Sheet:A26804
