ABflo[R] 647 Rabbit anti-Mouse CD182/CXCR2 monoclonal antibody
Product Sizes
10 tests
£ POA
A26758-10TESTS
100 tests
£342.00
A26758-100TESTS
200 tests
£544.00
A26758-200TESTS
500 tests
£973.00
A26758-500TESTS
About this Product
- SKU:
- A26758
- Additional Names:
- CD128|CDw128|Cmkar2|Gpcr16|IL-8rb|IL-8Rh|IL8RA|Il8rb|mIL-8RH
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables chemokine receptor activity. Acts upstream of or within negative regulation of apoptotic process. Predicted to be located in several cellular components, including cell surface; mast cell granule; and mitotic spindle. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; embryo mesenchyme; epithelium; and heart. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; acute pyelonephritis; end stage renal disease; and urinary bladder cancer. Orthologous to human CXCR2 (C-X-C motif chemokine receptor 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26758
