ABflo[R] 450 Rabbit anti-Human/Monkey Ki67 monoclonal antibody
Product Sizes
10 tests
£ POA
A26735-10TESTS
100 tests
£384.00
A26735-100TESTS
200 tests
£610.00
A26735-200TESTS
500 tests
£1074.00
A26735-500TESTS
About this Product
- SKU:
- A26735
- Additional Names:
- KIA|MIB-|MIB-1|PPP1R105
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 450
- Extra Details:
- Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 319kDa/359kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- PAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26735
