PE Rabbit anti-Human CaSR monoclonal antibody
Product Sizes
10 tests
£ POA
A26712-10TESTS
100 tests
£503.00
A26712-100TESTS
200 tests
£824.00
A26712-200TESTS
500 tests
£1478.00
A26712-500TESTS
About this Product
- SKU:
- A26712
- Additional Names:
- CAR|EIG8|FHH|FIH|GPRC2A|hCasR|HHC|HHC1|HYPOC1|NSHPT|PCAR1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 121kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26712
