ABflo[R] 647 Rabbit anti-Mouse CD88/C5aR monoclonal antibody
Product Sizes
10 tests
£ POA
A26711-10TESTS
100 tests
£259.00
A26711-100TESTS
200 tests
£402.00
A26711-200TESTS
500 tests
£693.00
A26711-500TESTS
About this Product
- SKU:
- A26711
- Additional Names:
- C5aR|C5r1|Cd88|D7Msu1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables complement component C5a receptor activity. Involved in several processes, including astrocyte activation; positive regulation of vascular endothelial growth factor production; and regulation of granulocyte chemotaxis. Acts upstream of or within defense response to Gram-positive bacterium; neutrophil chemotaxis; and response to peptidoglycan. Predicted to be located in several cellular components, including apical part of cell; basolateral plasma membrane; and cell surface. Predicted to be active in plasma membrane. Is expressed in several structures, including brain; liver; neural ectoderm; and sensory organ. Orthologous to several human genes including OPRPN (opiorphin prepropeptide).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 39kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26711
