PE Rabbit anti-Mouse CD140b/PDGFRB Beta monoclonal antibody
Product Sizes
10 tests
£ POA
A26689-10TESTS
100 tests
£134.00
A26689-100TESTS
200 tests
£193.00
A26689-200TESTS
500 tests
£306.00
A26689-500TESTS
About this Product
- SKU:
- A26689
- Additional Names:
- CD140b|Pdgfr|PDGFR-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables platelet-derived growth factor-activated receptor activity and signaling receptor binding activity. Involved in several processes, including positive regulation of intracellular signal transduction; protein phosphorylation; and vasculature development. Acts upstream of or within several processes, including animal organ development; response to ceramide; and ruffle assembly. Located in cell surface; cytoplasm; and ruffle. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Used to study basal ganglia calcification; infantile myofibromatosis; myeloproliferative neoplasm; and severe nonproliferative diabetic retinopathy. Human ortholog(s) of this gene implicated in basal ganglia calcification; glioblastoma; infantile myofibromatosis; myeloproliferative neoplasm (multiple); and renal cell carcinoma. Orthologous to human PDGFRB (platelet derived growth factor receptor beta).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 123kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26689
