ABflo[R] 700 Rabbit anti-Human CD300F/IREM-1 monoclonal antibody
Product Sizes
10 tests
£ POA
A26634-10TESTS
100 tests
£384.00
A26634-100TESTS
200 tests
£622.00
A26634-200TESTS
500 tests
£1098.00
A26634-500TESTS
About this Product
- SKU:
- A26634
- Additional Names:
- CD300f|CD300LF|CLM-1|CLM1|CMRF35-like molecule 1|IgSF13|IREM-1|IREM1|LMIR3|NKIR
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 700
- Extra Details:
- This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 18kDa/21kDa/26kDa/32kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26634
