ABflo[R] 700 Rabbit anti-Mouse CD23 monoclonal antibody
Product Sizes
10 tests
£ POA
A26579-10TESTS
100 tests
£134.00
A26579-100TESTS
200 tests
£193.00
A26579-200TESTS
500 tests
£306.00
A26579-500TESTS
About this Product
- SKU:
- A26579
- Additional Names:
- CD23|Fce2|Fcer2|Ly-42
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 700
- Extra Details:
- Predicted to enable carbohydrate binding activity. Acts upstream of or within positive regulation of humoral immune response mediated by circulating immunoglobulin. Located in external side of plasma membrane. Orthologous to human FCER2 (Fc fragment of IgE receptor II).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26579
