ABflo[R] 647 Rabbit anti-Mouse CD209b/DC-SIGNR1 monoclonal antibody
Product Sizes
10 tests
£ POA
A26548-10TESTS
100 tests
£360.00
A26548-100TESTS
200 tests
£580.00
A26548-200TESTS
500 tests
£1020.00
A26548-500TESTS
About this Product
- SKU:
- A26548
- Additional Names:
- 1810030I22Rik|DC-SIGNR1|mSIGNR1|OtB7|SIGNR1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- CD209B, also known as SIGN-R1, is a mouse C-type lectin receptor predominantly expressed on macrophages in the spleen marginal zone and lymph nodes medulla. CD209B is a mouse homolog of human CD209/DC-SIGN and is involved in innate immune response. CD209B mediates the recognition and uptake of pathogen products, such as lipopolysaccharides (LPS), pneumococcal polysaccharides, and dextrans. CD209B has been demonstrated to facilitate the clearance of encapsulated pneumococcus by directly binding to C1q and activating complement through an immunoglobulin independent pathway.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26548
