PE Rabbit anti-Human/Mouse Nanog monoclonal antibody
Product Sizes
10 tests
£ POA
A26535-10TESTS
100 tests
£342.00
A26535-100TESTS
200 tests
£544.00
A26535-200TESTS
500 tests
£973.00
A26535-500TESTS
About this Product
- SKU:
- A26535
- Additional Names:
- 2410002E02Rik|ecat4|ENK|Stm1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 34kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26535
