ABflo[R] 700 Rabbit anti-Mouse CD2 monoclonal antibody
Product Sizes
10 tests
£ POA
A26528-10TESTS
100 tests
£146.00
A26528-100TESTS
200 tests
£211.00
A26528-200TESTS
500 tests
£354.00
A26528-500TESTS
About this Product
- SKU:
- A26528
- Additional Names:
- LFA-2|Ly-37|Ly37
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 700
- Extra Details:
- Enables identical protein binding activity. Predicted to be involved in T cell activation; heterotypic cell-cell adhesion; and positive regulation of cytokine production. Located in several cellular components, including cell-cell junction; cytoplasmic side of plasma membrane; and external side of plasma membrane. Is anchored component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD2 (CD2 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26528
