ABflo[R] 647 Rabbit anti-Mouse CD94 monoclonal antibody
Product Sizes
10 tests
£ POA
A26485-10TESTS
100 tests
£116.00
A26485-100TESTS
200 tests
£164.00
A26485-200TESTS
500 tests
£259.00
A26485-500TESTS
About this Product
- SKU:
- A26485
- Additional Names:
- CD94
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- CD94 is a 43/39 kD C-type lectin, also known as Kp43. It is present on all NK cells, NKT cells, and a subset of CD8-positive T lymphocytes in most mouse strains. CD94 is a type-II transmembrane protein with an extracellular lectin-like domain and a short cytoplasmic tail. CD94 is expressed as a disulphide-linked heterodimer with a NKG2 subunit believed to mediate signal transduction. When associated with NKG2A, the complex triggers inhibition; when associated with NKG2C, the complex triggers stimulation. The receptor complex of CD94 and NKG2 receptors bind to the ligand, Qa-1, and are thought to play a role in maintaining self-tolerance in developing NK cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- CVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26485
